PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C013173P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NAC
Protein Properties Length: 561aa    MW: 63256.5 Da    PI: 4.7531
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C013173P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.3e-52161422128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppGfrFhPtd+el+ +yLk+k+ g+k++l +v++++d+yk++P++Lp  +k+k+++++w+fF++rd+ky++g ++nrat++gyWk tgkd++v++
  MELO3C013173P1  16 PPGFRFHPTDDELILYYLKRKICGRKIKL-DVVADIDVYKWDPEELPglSKLKTGDRQWFFFCPRDRKYPNGAKSNRATSQGYWKVTGKDRTVKC 109
                     8****************************.99***************6559999***************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kktLvfy+grapkge+tdWvmhey++
  MELO3C013173P1 110 -NSRNVGVKKTLVFYRGRAPKGERTDWVMHEYTM 142
                     .999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5813165IPR003441NAC domain
PROSITE profilePS5100555.0315165IPR003441NAC domain
PfamPF023651.3E-2716141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MKLLRLTSAD DDNPWPPGFR FHPTDDELIL YYLKRKICGR KIKLDVVADI DVYKWDPEEL  60
PGLSKLKTGD RQWFFFCPRD RKYPNGAKSN RATSQGYWKV TGKDRTVKCN SRNVGVKKTL  120
VFYRGRAPKG ERTDWVMHEY TMNEEELTRC TNVQSYYAVY KVFKKSGPGP KNGEQYGAPF  180
KEEDWVDEEF RDFNFSDDQE IPAEKPKMDA TDIEGETCQA THFSLDDFDR WMKQISDEDL  240
FQSLEADPCA NSLPLGGGQK DYASTIDLHS QEYILPRSVE VPNSKQQPSI SPESNSNSDV  300
SQLHPFQNHD AKSPPNVSEL ASFLFEGDYL EMDDLVGPEF NLSNTQKPSG SGNLQLEEIN  360
GLNELDQFHD AVMFLDDFGP LEYGPSPNLY KNENSSNVTN PMDGQFQSNP AITGQIGNQM  420
LPDSAMNGLT LSEMQRTSGV LCDSSNFVGE ANENEVGEHN SASRVSSALW AFVESIPTTP  480
ASAAEVNQSF DFDRIPSFSR RRLNMNSTTV SSINSSSLMT RRSGRSKKGR FFLFSIVGAL  540
FAILWVFMGA VRMWQRCISL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4811421140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817980.0LN681798.1 Cucumis melo genomic scaffold, anchoredscaffold00019.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447750.10.0PREDICTED: uncharacterized protein LOC103490150
TrEMBLA0A0A0K8N50.0A0A0A0K8N5_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s06210.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-127NAC domain containing protein 17